Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (27 families) |
Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein) automatically mapped to Pfam PF00613 this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain |
Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48402] (77 PDB entries) |
Domain d3mjwa3: 3mjw A:544-725 [213288] Other proteins in same PDB: d3mjwa1, d3mjwa2, d3mjwa4, d3mjwa5 automated match to d1e8ya1 complexed with wyf |
PDB Entry: 3mjw (more details), 2.87 Å
SCOPe Domain Sequences for d3mjwa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mjwa3 a.118.1.6 (A:544-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]} raempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqei vaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllql vqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrg cg
Timeline for d3mjwa3:
View in 3D Domains from same chain: (mouse over for more information) d3mjwa1, d3mjwa2, d3mjwa4, d3mjwa5 |