Lineage for d3mjwa3 (3mjw A:544-725)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2338713Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
    automatically mapped to Pfam PF00613
    this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain
  6. 2338714Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 2338715Species Human (Homo sapiens) [TaxId:9606] [48402] (77 PDB entries)
  8. 2338753Domain d3mjwa3: 3mjw A:544-725 [213288]
    Other proteins in same PDB: d3mjwa1, d3mjwa2, d3mjwa4, d3mjwa5
    automated match to d1e8ya1
    complexed with wyf

Details for d3mjwa3

PDB Entry: 3mjw (more details), 2.87 Å

PDB Description: PI3 Kinase gamma with a benzofuranone inhibitor
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3mjwa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mjwa3 a.118.1.6 (A:544-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
raempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqei
vaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllql
vqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrg
cg

SCOPe Domain Coordinates for d3mjwa3:

Click to download the PDB-style file with coordinates for d3mjwa3.
(The format of our PDB-style files is described here.)

Timeline for d3mjwa3: