SCOPe 2.04: Domain d3mgvc1: 3mgv C:20-129

Lineage for d3mgvc1 (3mgv C:20-129)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (2 families)

5. Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)

6. Protein Cre recombinase [47825] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [47826] (20 PDB entries)
   Uniprot P06956 20-341

8. Domain d3mgvc1: 3mgv C:20-129 [213257]
   Other proteins in same PDB: d3mgva2, d3mgvb2, d3mgvc2, d3mgvd2
   automated match to d2crxa1
   protein/DNA complex; complexed with vo4

Details for d3mgvc1

PDB Entry: 3mgv, 2.29 Å

PDB Description: Cre recombinase-DNA transition state

PDB Compounds: (C:) Recombinase cre

SCOPe Domain Sequences for d3mgvc1:

Sequence; same for both SEQRES and ATOM records:

>d3mgvc1 a.60.9.1 (C:20-129) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

Timeline for d3mgvc1:

• d3mgvc1 first appeared in SCOPe 2.03
  
• d3mgvc1 appears in SCOPe 2.05
  
• d3mgvc1 appears in the current release, SCOPe 2.08