SCOPe 2.03: Domain d3mcqa1: 3mcq A:7-135

Lineage for d3mcqa1 (3mcq A:7-135)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families)

5. Family d.79.4.0: automated matches [227181] (1 protein)
   not a true family

6. Protein automated matches [226901] (5 species)
   not a true protein

7. Species Methylobacillus flagellatus [TaxId:265072] [225898] (1 PDB entry)

8. Domain d3mcqa1: 3mcq A:7-135 [213204]
   Other proteins in same PDB: d3mcqa2
   automated match to d3c9ua1
   complexed with 1pe, na, peg, pg4, pge

Details for d3mcqa1

PDB Entry: 3mcq, 1.91 Å

PDB Description: crystal structure of thiamine-monophosphate kinase (mfla_0573) from methylobacillus flagellatus kt at 1.91 a resolution

PDB Compounds: (A:) Thiamine-monophosphate kinase

SCOPe Domain Sequences for d3mcqa1:

Sequence; same for both SEQRES and ATOM records:

>d3mcqa1 d.79.4.0 (A:7-135) automated matches {Methylobacillus flagellatus [TaxId: 265072]}
liqryfrrahpsavlgvgddaaliqpspgmelavsadmlvanthfypnidpwligwksla
vnisdmaamgaqprwatltialpeadedwiskfaagffacaaqfdialiggdttrgplti
svqimgetp

Timeline for d3mcqa1:

• d3mcqa1 is new in SCOPe 2.03-stable
  
• d3mcqa1 appears in SCOPe 2.04
  
• d3mcqa1 appears in the current release, SCOPe 2.08