Lineage for d1cz8l2 (1cz8 L:108-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748802Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2748803Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 2748942Domain d1cz8l2: 1cz8 L:108-213 [21318]
    Other proteins in same PDB: d1cz8h1, d1cz8h2, d1cz8l1, d1cz8v_, d1cz8w_, d1cz8x1, d1cz8y1, d1cz8y2
    part of humanized Fab-12 neutralizing VEGF; affinity matured
    complexed with so4

Details for d1cz8l2

PDB Entry: 1cz8 (more details), 2.4 Å

PDB Description: vascular endothelial growth factor in complex with an affinity matured antibody
PDB Compounds: (L:) light chain of neutralizing antibody

SCOPe Domain Sequences for d1cz8l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cz8l2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d1cz8l2:

Click to download the PDB-style file with coordinates for d1cz8l2.
(The format of our PDB-style files is described here.)

Timeline for d1cz8l2: