Lineage for d3m8ta_ (3m8t A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679369Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1679370Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1679371Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 1679510Protein automated matches [190079] (7 species)
    not a true protein
  7. 1679535Species Bradyrhizobium japonicum [TaxId:224911] [226051] (2 PDB entries)
  8. 1679536Domain d3m8ta_: 3m8t A: [213157]
    automated match to d2gmna1
    complexed with 4nz, dms, fmt, zn

Details for d3m8ta_

PDB Entry: 3m8t (more details), 1.33 Å

PDB Description: crystal structure of the complex between class b3 beta-lactamase bjp-1 and 4-nitrobenzene-sulfonamide
PDB Compounds: (A:) 'Blr6230 protein

SCOPe Domain Sequences for d3m8ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m8ta_ d.157.1.1 (A:) automated matches {Bradyrhizobium japonicum [TaxId: 224911]}
kkwtapfepfqlidniyyvgtdgiavyviktsqglilmdtampqstgmikdniaklgfkv
adiklilnthahldhtggfaeikketgaqlvagerdkplleggyypgdeknedlafpavk
vdravkegdrvtlgdttltahatpghspgctswemtvkdgkedrevlffcsgtvalnrlv
gqptyagivddyratfakakamkidvllgphpevygmqakraemkdgapnpfikpgelvt
yatslsedfdkqlakqtaalekk

SCOPe Domain Coordinates for d3m8ta_:

Click to download the PDB-style file with coordinates for d3m8ta_.
(The format of our PDB-style files is described here.)

Timeline for d3m8ta_: