Lineage for d3lchb_ (3lch B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1342158Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1342159Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1342672Protein automated matches [190095] (17 species)
    not a true protein
  7. 1342717Species Escherichia coli [TaxId:83333] [225841] (10 PDB entries)
  8. 1342741Domain d3lchb_: 3lch B: [212803]
    automated match to d2wnqa_
    complexed with so4; mutant

Details for d3lchb_

PDB Entry: 3lch (more details), 2.04 Å

PDB Description: the d-sialic acid aldolase mutant v251r
PDB Compounds: (B:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d3lchb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lchb_ c.1.10.1 (B:) automated matches {Escherichia coli [TaxId: 83333]}
atnlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereq
vleivaeeakgkikliahvgcvstaesqqlaasakrygfdavsavtpfyypfsfeehcdh
yraiidsadglpmvvynipalsgvkltldqintlvtlpgvgalkqtsgdlyqmeqirreh
pdlvlyngydeifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnk
vidlliktgrfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmqer

SCOPe Domain Coordinates for d3lchb_:

Click to download the PDB-style file with coordinates for d3lchb_.
(The format of our PDB-style files is described here.)

Timeline for d3lchb_: