SCOPe 2.04: Domain d3lcha_: 3lch A:

Lineage for d3lcha_ (3lch A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (19 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [225841] (10 PDB entries)

8. Domain d3lcha_: 3lch A: [212802]
   automated match to d2wnqa_
   complexed with so4; mutant

Details for d3lcha_

PDB Entry: 3lch, 2.04 Å

PDB Description: the d-sialic acid aldolase mutant v251r

PDB Compounds: (A:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d3lcha_:

Sequence; same for both SEQRES and ATOM records:

>d3lcha_ c.1.10.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
nlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereqvl
eivaeeakgkikliahvgcvstaesqqlaasakrygfdavsavtpfyypfsfeehcdhyr
aiidsadglpmvvynipalsgvkltldqintlvtlpgvgalkqtsgdlyqmeqirrehpd
lvlyngydeifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnkvi
dlliktgrfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmqer

Timeline for d3lcha_:

• d3lcha_ first appeared in SCOPe 2.03
  
• d3lcha_ appears in SCOPe 2.05
  
• d3lcha_ appears in the current release, SCOPe 2.08