Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (91 species) not a true protein |
Species Streptococcus mutans [TaxId:210007] [226048] (1 PDB entry) |
Domain d3l9ca1: 3l9c A:0-225 [212760] Other proteins in same PDB: d3l9ca2 automated match to d3m7wa_ |
PDB Entry: 3l9c (more details), 1.6 Å
SCOPe Domain Sequences for d3l9ca1:
Sequence, based on SEQRES records: (download)
>d3l9ca1 c.1.10.0 (A:0-225) automated matches {Streptococcus mutans [TaxId: 210007]} smkivvpvmpqnieeanqldltridstdiiewradylvkddiltvapaifekfsghevif tlrtekeggnislsnedylaiirdiaalyqpdyidfeyfsyrdvleemydfsnlilsyhn feetpenlmevfseltalaprvvkiavmpkneqdvldlmnytrgfktlnpnqeyvtmsms klgrisrlaadligsswtfasleqesapgqisladmrkikevldan
>d3l9ca1 c.1.10.0 (A:0-225) automated matches {Streptococcus mutans [TaxId: 210007]} smkivvpvmpqnieeanqldltridstdiiewradylvkddiltvapaifekfsghevif tlrtekeggnislsnedylaiirdiaalyqpdyidfeyfsyrdvleemydfsnlilsyhn feetpenlmevfseltalaprvvkiavmpkneqdvldlmnytrgfktlnpnqeyvtmsms klgrisrlaadligsswtfaslqisladmrkikevldan
Timeline for d3l9ca1: