Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (81 species) not a true protein |
Species Brucella melitensis [TaxId:29459] [225803] (1 PDB entry) |
Domain d3kzuc2: 3kzu C:260-420 [212611] automated match to d1j3na2 complexed with edo, so4 |
PDB Entry: 3kzu (more details), 1.75 Å
SCOPe Domain Sequences for d3kzuc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kzuc2 c.95.1.0 (C:260-420) automated matches {Brucella melitensis [TaxId: 29459]} kiyaevigygmsgdafhitaptesgegaqrcmvaalkragivpdeidyinahgtstmadt ielgavervvgeaaakismsstkssighllgaagaaeavfstlairdniapatlnldnpa aqtridlvphkprerkidvalsnsfgfggtnaslvlrryta
Timeline for d3kzuc2:
View in 3D Domains from other chains: (mouse over for more information) d3kzua1, d3kzua2, d3kzub1, d3kzub2 |