Lineage for d3kofa_ (3kof A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1342158Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1342159Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1342672Protein automated matches [190095] (17 species)
    not a true protein
  7. 1342717Species Escherichia coli [TaxId:83333] [225841] (10 PDB entries)
  8. 1342738Domain d3kofa_: 3kof A: [212475]
    automated match to d1f05a_
    complexed with so4; mutant

Details for d3kofa_

PDB Entry: 3kof (more details), 1.9 Å

PDB Description: crystal structure of the double mutant f178y/r181e of e.coli transaldolase b
PDB Compounds: (A:) transaldolase b

SCOPe Domain Sequences for d3kofa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kofa_ c.1.10.1 (A:) automated matches {Escherichia coli [TaxId: 83333]}
tdkltslrqyttvvadtgdiaamklyqpqdattnpslilnaaqipeyrkliddavawakq
qsndraqqivdatdklavnigleilklvpgristevdarlsydteasiakakrliklynd
agisndriliklastwqgiraaeqlekegincnltllfsfaqaracaeagvflispyvge
ildwykantdkkeyapaedpgvvsvseiyqyykehgyetvvmgasfrnigeilelagcdr
ltiaptllkelaesegaierklsytgevkarpariteseflwqhnqdpmavdklaegirk
faidqeklekmigdll

SCOPe Domain Coordinates for d3kofa_:

Click to download the PDB-style file with coordinates for d3kofa_.
(The format of our PDB-style files is described here.)

Timeline for d3kofa_: