SCOP 1.69: Domain d1a4kl2: 1a4k L:113-212

Lineage for d1a4kl2 (1a4k L:113-212)

Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [88569] (78 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
Domain d1a4kl2: 1a4k L:113-212 [21246]
Other proteins in same PDB: d1a4ka1, d1a4kb1, d1a4kb2, d1a4kh1, d1a4kh2, d1a4kl1

Details for d1a4kl2

PDB Entry: 1a4k (more details), 2.4 Å

PDB Description: diels alder catalytic antibody with transition state analogue

SCOP Domain Sequences for d1a4kl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4kl2 b.1.1.2 (L:113-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
psvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdst
yslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOP Domain Coordinates for d1a4kl2:

Click to download the PDB-style file with coordinates for d1a4kl2.
(The format of our PDB-style files is described here.)

Timeline for d1a4kl2: