Lineage for d3km6a2 (3km6 A:79-209)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2325991Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2326363Protein Class pi GST [81347] (4 species)
  7. 2326364Species Human (Homo sapiens) [TaxId:9606] [47619] (66 PDB entries)
  8. 2326403Domain d3km6a2: 3km6 A:79-209 [212420]
    Other proteins in same PDB: d3km6a1, d3km6b1
    automated match to d1gssa1
    complexed with ca, eaa, gsh; mutant

Details for d3km6a2

PDB Entry: 3km6 (more details), 2.1 Å

PDB Description: crystal structure of the human gst pi c47s/y108v double mutant in complex with the ethacrynic acid-glutathione conjugate
PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d3km6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3km6a2 a.45.1.1 (A:79-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ygkdqqeaalvdmvndgvedlrckyislivtnyeagkddyvkalpgqlkpfetllsqnqg
gktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflaspey
vnlpingngkq

SCOPe Domain Coordinates for d3km6a2:

Click to download the PDB-style file with coordinates for d3km6a2.
(The format of our PDB-style files is described here.)

Timeline for d3km6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3km6a1