SCOPe 2.03: Domain d3klia2: 3kli A:430-551

Lineage for d3klia2 (3kli A:430-551)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (20 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11678] [225971] (14 PDB entries)

8. Domain d3klia2: 3kli A:430-551 [212412]
   Other proteins in same PDB: d3klia1, d3klib_
   automated match to d1bqna1

Details for d3klia2

PDB Entry: 3kli, 2.65 Å

PDB Description: crystal structure of unliganded azt-resistant hiv-1 reverse transcriptase

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d3klia2:

Sequence; same for both SEQRES and ATOM records:

>d3klia2 c.55.3.0 (A:430-551) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
kl

Timeline for d3klia2:

• d3klia2 is new in SCOPe 2.03-stable
  
• d3klia2 appears in SCOPe 2.04
  
• d3klia2 appears in the current release, SCOPe 2.08