Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (20 species) not a true protein |
Species Human immunodeficiency virus type 1 [TaxId:11678] [225971] (14 PDB entries) |
Domain d3klia2: 3kli A:430-551 [212412] Other proteins in same PDB: d3klia1, d3klib_ automated match to d1bqna1 |
PDB Entry: 3kli (more details), 2.65 Å
SCOPe Domain Sequences for d3klia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3klia2 c.55.3.0 (A:430-551) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]} ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd kl
Timeline for d3klia2: