Lineage for d3kgaa_ (3kga A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1434946Protein MAP kinase activated protein kinase 2, mapkap2 [82789] (1 species)
    CaMK group; MAPKAPK subfamily; serine/threonine kinase
  7. 1434947Species Human (Homo sapiens) [TaxId:9606] [82790] (13 PDB entries)
  8. 1434949Domain d3kgaa_: 3kga A: [212350]
    automated match to d1nxkc_
    complexed with lx9, mg

Details for d3kgaa_

PDB Entry: 3kga (more details), 2.55 Å

PDB Description: crystal structure of mapkap kinase 2 (mk2) complexed with a potent 3- aminopyrazole atp site inhibitor
PDB Compounds: (A:) MAP kinase-activated protein kinase 2

SCOPe Domain Sequences for d3kgaa_:

Sequence, based on SEQRES records: (download)

>d3kgaa_ d.144.1.7 (A:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettgekydkscdmw
slgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewsevseevkmlirnllk
teptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsalatmr

Sequence, based on observed residues (ATOM records): (download)

>d3kgaa_ d.144.1.7 (A:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettgekydkscdmw
slgvimyillcgyppfyspgmktrirmgqyefpnpewsevseevkmlirnllkteptqrm
titefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsalatmr

SCOPe Domain Coordinates for d3kgaa_:

Click to download the PDB-style file with coordinates for d3kgaa_.
(The format of our PDB-style files is described here.)

Timeline for d3kgaa_: