Lineage for d3k9sc1 (3k9s C:1-90)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1256372Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1256627Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1256628Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 1256758Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)
  7. 1256817Species Escherichia coli [TaxId:83333] [224842] (1 PDB entry)
  8. 1256820Domain d3k9sc1: 3k9s C:1-90 [212248]
    Other proteins in same PDB: d3k9sa2, d3k9sb2, d3k9sc2, d3k9sd2
    automated match to d1d5na1
    complexed with mn, peo

Details for d3k9sc1

PDB Entry: 3k9s (more details), 1.55 Å

PDB Description: Crystal structure of the peroxide-bound manganese superoxide dismutase.
PDB Compounds: (C:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d3k9sc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k9sc1 a.2.11.1 (C:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 83333]}
sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
dqlpadkktvlrnnagghanhslfwkglkk

SCOPe Domain Coordinates for d3k9sc1:

Click to download the PDB-style file with coordinates for d3k9sc1.
(The format of our PDB-style files is described here.)

Timeline for d3k9sc1: