Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
Species Fab D2.3 (mouse), kappa L chain [49045] (4 PDB entries) |
Domain d1yeil2: 1yei L:108-214 [21172] Other proteins in same PDB: d1yeih1, d1yeil1 |
PDB Entry: 1yei (more details), 1.9 Å
SCOP Domain Sequences for d1yeil2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yeil2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Fab D2.3 (mouse), kappa L chain} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1yeil2: