SCOPe 2.03: Domain d3ij6d_: 3ij6 D:

Lineage for d3ij6d_ (3ij6 D:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (16 species)
   not a true protein

7. Species Lactobacillus acidophilus [TaxId:1579] [225736] (1 PDB entry)

8. Domain d3ij6d_: 3ij6 D: [211716]
   automated match to d2f6ka1
   complexed with na, zn

Details for d3ij6d_

PDB Entry: 3ij6, 2 Å

PDB Description: crystal structure of an uncharacterized metal-dependent hydrolase from lactobacillus acidophilus

PDB Compounds: (D:) uncharacterized metal-dependent hydrolase

SCOPe Domain Sequences for d3ij6d_:

Sequence; same for both SEQRES and ATOM records:

>d3ij6d_ c.1.9.0 (D:) automated matches {Lactobacillus acidophilus [TaxId: 1579]}
ltkidayahilpakyyqkmlsvepnipnmfpfikiktlmdlderltkwpdqntkqvisla
nispedftdsktsaelcqsaneelsnlvdqhpgkfagavailpmnniesackvissikdd
enlvgaqiftrhlgksiadkefrpvlaqaaklhvplwmhpvfdarkpdnnlvfsweyels
qamlqlvqsdlfqdypnlkilvhhagamvpffsgridhildekhaqdfkkfyvdtailgn
tpalqlaidyygidhvlfgtdapfavmpsgadqiitqaindltisdkdkqkifhdnyysl
ik

Timeline for d3ij6d_:

• d3ij6d_ is new in SCOPe 2.03-stable
  
• d3ij6d_ appears in SCOPe 2.04
  
• d3ij6d_ appears in the current release, SCOPe 2.08, called d3ij6d1