SCOPe 2.07: Domain d3ihia_: 3ihi A:

Lineage for d3ihia_ (3ihi A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein automated matches [190469] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225826] (11 PDB entries)

8. Domain d3ihia_: 3ihi A: [211690]
   automated match to d3ed7a_
   complexed with so4

Details for d3ihia_

PDB Entry: 3ihi, 1.94 Å

PDB Description: crystal structure of mouse thymidylate synthase

PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d3ihia_:

Sequence; same for both SEQRES and ATOM records:

>d3ihia_ d.117.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvle
ellwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgaey
kdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvng
elscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplk
iqlqreprpfpklkilrkvetiddfkvedfqiegynphpt

Timeline for d3ihia_:

• d3ihia_ first appeared in SCOPe 2.03
  
• d3ihia_ appears in SCOPe 2.06
  
• d3ihia_ appears in the current release, SCOPe 2.08