Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries) |
Domain d3if1c1: 3if1 C:2-107 [211625] Other proteins in same PDB: d3if1a2, d3if1c2 complexed with mg, nga, zn |
PDB Entry: 3if1 (more details), 2.39 Å
SCOPe Domain Sequences for d3if1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3if1c1 b.1.1.1 (C:2-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqltqsplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrfs gvpdrfsgsgsgtdftlkissveaedlgvyfcsqsthvptfgggtkleik
Timeline for d3if1c1: