Lineage for d3i6ya_ (3i6y A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2510099Species Oleispira antarctica [TaxId:188908] [196342] (3 PDB entries)
  8. 2510103Domain d3i6ya_: 3i6y A: [211540]
    automated match to d3s8ya_
    complexed with cl, edo, peg

Details for d3i6ya_

PDB Entry: 3i6y (more details), 1.75 Å

PDB Description: structure of an esterase from the oil-degrading bacterium oleispira antarctica
PDB Compounds: (A:) Esterase APC40077

SCOPe Domain Sequences for d3i6ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i6ya_ c.69.1.0 (A:) automated matches {Oleispira antarctica [TaxId: 188908]}
sienlssnksfggwhkqyshvsntlncamrfaiylppqastgakvpvlywlsgltcsden
fmqkagaqrlaaelgiaivapdtsprgegvaddegydlgqgagfyvnatqapwnrhyqmy
dyvvnelpeliesmfpvsdkraiaghsmgghgaltialrnperyqsvsafspinnpvncp
wgqkaftaylgkdtdtwreydasllmraakqyvpalvdqgeadnflaeqlkpevleaaas
snnyplelrshegydhsyyfiasfiedhlrfhsnylna

SCOPe Domain Coordinates for d3i6ya_:

Click to download the PDB-style file with coordinates for d3i6ya_.
(The format of our PDB-style files is described here.)

Timeline for d3i6ya_: