Lineage for d1ngph2 (1ngp H:121-220)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104326Species Fab N1G9 (mouse/human), kappa L chain [49028] (2 PDB entries)
  8. 104327Domain d1ngph2: 1ngp H:121-220 [21123]
    Other proteins in same PDB: d1ngph1, d1ngpl1

Details for d1ngph2

PDB Entry: 1ngp (more details), 2.4 Å

PDB Description: n1g9 (igg1-lambda) fab fragment complexed with (4-hydroxy-3- nitrophenyl) acetate

SCOP Domain Sequences for d1ngph2:

Sequence, based on SEQRES records: (download)

>d1ngph2 b.1.1.2 (H:121-220) Immunoglobulin (constant domains of L and H chains) {Fab N1G9 (mouse/human), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsspwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d1ngph2 b.1.1.2 (H:121-220) Immunoglobulin (constant domains of L and H chains) {Fab N1G9 (mouse/human), kappa L chain}
akttppsvyplapgssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpsspwpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1ngph2:

Click to download the PDB-style file with coordinates for d1ngph2.
(The format of our PDB-style files is described here.)

Timeline for d1ngph2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ngph1