Class b: All beta proteins [48724] (176 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189530] (3 PDB entries) |
Domain d3hhqo_: 3hhq O: [211054] automated match to d1sixa_ complexed with cl, edo, gol, na, peg, so4 |
PDB Entry: 3hhq (more details), 2 Å
SCOPe Domain Sequences for d3hhqo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hhqo_ b.85.4.0 (O:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kvlkiqlrsasatvptkgsataagydiyasqditipamgqgmvstdisftvpvgtygria prsglavkngiqtgagvvdrdytgevkvvlfnhsqrdfaikkgdrvaqlilekivddaqi vvvdsle
Timeline for d3hhqo_: