Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d3h9ye1: 3h9y E:336-438 [210924] automated match to d1f6ab1 complexed with bma, man, nag, nh4 |
PDB Entry: 3h9y (more details), 2.23 Å
SCOPe Domain Sequences for d3h9ye1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h9ye1 b.1.1.2 (E:336-438) automated matches {Human (Homo sapiens) [TaxId: 9606]} vsaylsrpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvqhstrkeekqrng tltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsg
Timeline for d3h9ye1:
View in 3D Domains from other chains: (mouse over for more information) d3h9ya1, d3h9ya2, d3h9yb1, d3h9yb2 |