Class b: All beta proteins [48724] (174 folds) |
Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies) consists of eight 4-stranded beta-sheet motifs; meander also found in some members of the WD40-repeat superfamily |
Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) automatically mapped to Pfam PF00930 |
Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins) Pfam PF00930 |
Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [82174] (68 PDB entries) Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487 |
Domain d3h0ca1: 3h0c A:39-508 [210754] Other proteins in same PDB: d3h0ca2, d3h0cb2 automated match to d1nu6a1 complexed with nag, ndg, ps4 |
PDB Entry: 3h0c (more details), 2.66 Å
SCOPe Domain Sequences for d3h0ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h0ca1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq
Timeline for d3h0ca1: