Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein Class mu GST [81359] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [52867] (16 PDB entries) Uniprot P09488 ! Uniprot P28161 |
Domain d3gurc1: 3gur C:1-84 [210656] Other proteins in same PDB: d3gura2, d3gurb2, d3gurc2, d3gurd2 automated match to d1xw5a2 complexed with byg, edo, gsh |
PDB Entry: 3gur (more details), 2.5 Å
SCOPe Domain Sequences for d3gurc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gurc1 c.47.1.5 (C:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp ylidgthkitqsnailryiarkhn
Timeline for d3gurc1: