Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) |
Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins) |
Protein Surfactant protein [57949] (3 species) |
Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (26 PDB entries) |
Domain d3g84b2: 3g84 B:205-234 [210454] Other proteins in same PDB: d3g84a1, d3g84b1, d3g84c1 complexed with ca, man; mutant |
PDB Entry: 3g84 (more details), 2.3 Å
SCOPe Domain Sequences for d3g84b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g84b2 h.1.1.1 (B:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]} aslrqqvealqgqvqhlqaafsqykkvelf
Timeline for d3g84b2:
View in 3D Domains from other chains: (mouse over for more information) d3g84a1, d3g84a2, d3g84c1, d3g84c2 |