Lineage for d3futa_ (3fut A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2502162Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2502163Protein automated matches [190689] (81 species)
    not a true protein
  7. 2502726Species Thermus thermophilus HB8 [TaxId:300852] [225633] (5 PDB entries)
  8. 2502727Domain d3futa_: 3fut A: [210179]
    automated match to d3tpzb_

Details for d3futa_

PDB Entry: 3fut (more details), 1.52 Å

PDB Description: apo-form of t. thermophilus 16s rrna a1518 and a1519 methyltransferase (ksga) in space group p21212
PDB Compounds: (A:) Dimethyladenosine transferase

SCOPe Domain Sequences for d3futa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3futa_ c.66.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
aspqsvrallerhglfadkrfgqnflvseahlrriveaarpftgpvfevgpglgaltral
leagaevtaiekdlrlrpvleetlsglpvrlvfqdallypweevpqgsllvanlpyhiat
plvtrllktgrfarlvflvqkevaermtarpktpaygvltlrvahhavaerlfdlppgaf
fpppkvwsslvrltptgalddpglfrlveaafgkrrktllnalaaagypkarveealral
glpprvraeeldleafrrlregle

SCOPe Domain Coordinates for d3futa_:

Click to download the PDB-style file with coordinates for d3futa_.
(The format of our PDB-style files is described here.)

Timeline for d3futa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3futb_