![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.13: Leukotriene A4 hydrolase catalytic domain [64338] (1 protein) adopts thermolysin-like fold |
![]() | Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64340] (44 PDB entries) Uniprot P09960 |
![]() | Domain d3fu6a2: 3fu6 A:209-460 [210129] Other proteins in same PDB: d3fu6a1, d3fu6a3 automated match to d1hs6a3 complexed with 80g, act, imd, yb, zn |
PDB Entry: 3fu6 (more details), 2.05 Å
SCOPe Domain Sequences for d3fu6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fu6a2 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]} lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg gmenpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl yspglppikpny
Timeline for d3fu6a2: