SCOPe 2.07: Domain d3fkrb_: 3fkr B:

Lineage for d3fkrb_ (3fkr B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (91 species)
   not a true protein

7. Species Azospirillum brasilense [TaxId:192] [225809] (5 PDB entries)

8. Domain d3fkrb_: 3fkr B: [210000]
   automated match to d3dz1a_
   complexed with na, po4

Details for d3fkrb_

PDB Entry: 3fkr, 1.8 Å

PDB Description: structure of l-2-keto-3-deoxyarabonate dehydratase complex with pyruvate

PDB Compounds: (B:) L-2-keto-3-deoxyarabonate dehydratase

SCOPe Domain Sequences for d3fkrb_:

Sequence; same for both SEQRES and ATOM records:

>d3fkrb_ c.1.10.0 (B:) automated matches {Azospirillum brasilense [TaxId: 192]}
tprhrgifpvvpttfadtgdldlasqkravdfmidagsdglcilanfseqfaitdderdv
ltrtilehvagrvpvivttshystqvcaarslraqqlgaamvmamppyhgatfrvpeaqi
fefyarvsdaiaipimvqdapasgtalsapflarmareieqvayfxietpgaanklreli
rlggdaiegpwdgeeaitlladlhagatgamtgggfpdgirpileawregrhddayaryq
awlplinhenrqsgiltakalmreggviaserprhpmpelhpdtraellaiarrldplvl
rwah

Timeline for d3fkrb_:

• d3fkrb_ first appeared in SCOPe 2.03
  
• d3fkrb_ appears in SCOPe 2.06
  
• d3fkrb_ appears in the current release, SCOPe 2.08