Lineage for d3fkdb_ (3fkd B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1613158Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1613159Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1614338Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1614339Protein automated matches [190151] (83 species)
    not a true protein
  7. 1614745Species Porphyromonas gingivalis [TaxId:837] [225603] (1 PDB entry)
  8. 1614747Domain d3fkdb_: 3fkd B: [209994]
    automated match to d3ftba_

Details for d3fkdb_

PDB Entry: 3fkd (more details), 2.5 Å

PDB Description: the crystal structure of l-threonine-o-3-phosphate decarboxylase from porphyromonas gingivalis
PDB Compounds: (B:) L-Threonine-O-3-Phosphate Decarboxylase

SCOPe Domain Sequences for d3fkdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fkdb_ c.67.1.0 (B:) automated matches {Porphyromonas gingivalis [TaxId: 837]}
ivnfsttvwtdgdkdhlekhlvenlncirhypepdagtlrqmlakrnsvdnnailvtngp
taafyqiaqafrgsrsliaipsfaeyedacrmyehevcfypsnedigeadfsnmdfcwlc
npnnpdgrllqrteilrllndhpdttfvldqsyvsftteevirpadikgrknlvmvysfs
haygipglrigyivankdfmkrvaafstpwavnalaieaakfilihpaqftlpirkwqrn
tvdfitalnrldgvevhpsgttffllrlkkgtaaelkkymleeynmlirdasnfrgldes
yvrittqrpaqnqlfikaletflek

SCOPe Domain Coordinates for d3fkdb_:

Click to download the PDB-style file with coordinates for d3fkdb_.
(The format of our PDB-style files is described here.)

Timeline for d3fkdb_: