SCOP 1.61: Domain d1flrh2: 1flr H:119-218

Lineage for d1flrh2 (1flr H:119-218)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab 4-4-20 (mouse), kappa L chain [48999] (2 PDB entries)

8. Domain d1flrh2: 1flr H:119-218 [20999]
   Other proteins in same PDB: d1flrh1, d1flrl1

Details for d1flrh2

PDB Entry: 1flr, 1.85 Å

PDB Description: 4-4-20 fab fragment

SCOP Domain Sequences for d1flrh2:

Sequence; same for both SEQRES and ATOM records:

>d1flrh2 b.1.1.2 (H:119-218) Immunoglobulin (constant domains of L and H chains) {Fab 4-4-20 (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Timeline for d1flrh2:

• d1flrh2 first appeared (with stable ids) in SCOP 1.55
  
• d1flrh2 appears in SCOP 1.59
  
• d1flrh2 appears in SCOP 1.63
  
• d1flrh2 appears in the current release, SCOPe 2.08