Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins) adopts thermolysin-like fold |
Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64340] (57 PDB entries) Uniprot P09960 |
Domain d3fh7a2: 3fh7 A:209-460 [209916] Other proteins in same PDB: d3fh7a1, d3fh7a3 automated match to d1hs6a3 complexed with 25p, act, gol, imd, yb, zn |
PDB Entry: 3fh7 (more details), 2.05 Å
SCOPe Domain Sequences for d3fh7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fh7a2 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]} lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg gmenpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl yspglppikpny
Timeline for d3fh7a2: