SCOPe 2.07: Domain d3fgoa4: 3fgo A:361-599

Lineage for d3fgoa4 (3fgo A:361-599)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
   unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432

4. Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family)

5. Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins)

6. Protein Calcium ATPase [81658] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (43 PDB entries)
   Uniprot P04191

8. Domain d3fgoa4: 3fgo A:361-599 [209905]
   Other proteins in same PDB: d3fgoa1, d3fgoa2, d3fgoa3, d3fgob1, d3fgob2, d3fgob3
   automated match to d1wpga3
   complexed with acp, act, cza, k, mf4, mg, mn

Details for d3fgoa4

PDB Entry: 3fgo, 2.5 Å

PDB Description: Crystal Structure of the E2 magnesium fluoride complex of the (SR) Ca2+-ATPase with bound CPA and AMPPCP

PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d3fgoa4:

Sequence; same for both SEQRES and ATOM records:

>d3fgoa4 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc
ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk
keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp
vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm

Timeline for d3fgoa4:

• d3fgoa4 first appeared in SCOPe 2.03
  
• d3fgoa4 appears in SCOPe 2.06
  
• d3fgoa4 appears in the current release, SCOPe 2.08