Lineage for d3fdsa2 (3fds A:241-352)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1447264Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 1447265Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families) (S)
  5. 1447266Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 1447267Protein DinB homolog (DBH) [100881] (3 species)
  7. 1447276Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (57 PDB entries)
  8. 1447285Domain d3fdsa2: 3fds A:241-352 [209861]
    Other proteins in same PDB: d3fdsa1, d3fdsd1, d3fdsd2
    automated match to d1n48a1
    protein/DNA complex; complexed with 1pe, edo, gol, peg, pge

Details for d3fdsa2

PDB Entry: 3fds (more details), 2.05 Å

PDB Description: structural insight into recruitment of translesion dna polymerase dpo4 to sliding clamp pcna
PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d3fdsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fdsa2 d.240.1.1 (A:241-352) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfieaigldkffdt

SCOPe Domain Coordinates for d3fdsa2:

Click to download the PDB-style file with coordinates for d3fdsa2.
(The format of our PDB-style files is described here.)

Timeline for d3fdsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fdsa1