Lineage for d3exeh2 (3exe H:186-329)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1603362Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 1603363Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 1603415Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (5 proteins)
    automatically mapped to Pfam PF02780
  6. 1603453Protein E1-beta subunit of pyruvate dehydrogenase, C-domain [69521] (2 species)
  7. 1603454Species Human (Homo sapiens) [TaxId:9606] [89713] (7 PDB entries)
  8. 1603458Domain d3exeh2: 3exe H:186-329 [209709]
    Other proteins in same PDB: d3exea_, d3exeb1, d3exec_, d3exed1, d3exee_, d3exef1, d3exeg_, d3exeh1
    automated match to d1umdb2
    complexed with gol, k, mn, tpp

Details for d3exeh2

PDB Entry: 3exe (more details), 1.98 Å

PDB Description: crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex
PDB Compounds: (H:) Pyruvate dehydrogenase E1 component subunit beta, mitochondrial

SCOPe Domain Sequences for d3exeh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3exeh2 c.48.1.2 (H:186-329) E1-beta subunit of pyruvate dehydrogenase, C-domain {Human (Homo sapiens) [TaxId: 9606]}
aqskdflipigkakierqgthitvvshsrpvghcleaaavlskegvecevinmrtirpmd
metieasvmktnhlvtveggwpqfgvgaeicarimegpafnfldapavrvtgadvpmpya
kilednsipqvkdiifaikktlni

SCOPe Domain Coordinates for d3exeh2:

Click to download the PDB-style file with coordinates for d3exeh2.
(The format of our PDB-style files is described here.)

Timeline for d3exeh2: