Lineage for d3evkd1 (3evk D:13-103)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303511Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2303512Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 2303540Protein Fe superoxide dismutase (FeSOD) [46611] (10 species)
  7. 2303594Species Pyrobaculum aerophilum [TaxId:13773] [100984] (2 PDB entries)
  8. 2303622Domain d3evkd1: 3evk D:13-103 [209681]
    Other proteins in same PDB: d3evka2, d3evka3, d3evkb2, d3evkb3, d3evkc2, d3evkc3, d3evkd2, d3evkd3
    automated match to d1p7ga1
    complexed with mn

Details for d3evkd1

PDB Entry: 3evk (more details), 1.85 Å

PDB Description: Crystal structure of the metal-bound superoxide dismutase from Pyrobaculum aerophilum
PDB Compounds: (D:) superoxide dismutase [fe]

SCOPe Domain Sequences for d3evkd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3evkd1 a.2.11.1 (D:13-103) Fe superoxide dismutase (FeSOD) {Pyrobaculum aerophilum [TaxId: 13773]}
vttkrytlpplpyaynalepyisaeimqlhhqkhhqgyvnganaaleklekfrkgeaqid
iravlrdlsfhlnghilhsifwpnmappgkg

SCOPe Domain Coordinates for d3evkd1:

Click to download the PDB-style file with coordinates for d3evkd1.
(The format of our PDB-style files is described here.)

Timeline for d3evkd1: