Lineage for d1fveb2 (1fve B:121-223)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 785070Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 785078Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
    SQ NA # humanized antibody
    Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region
    SQ NA # engineered antibody
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 785251Domain d1fveb2: 1fve B:121-223 [20967]
    Other proteins in same PDB: d1fvea1, d1fvea2, d1fveb1, d1fvec1, d1fvec2, d1fved1
    part of humanized Fab 4D5, herceptin

Details for d1fveb2

PDB Entry: 1fve (more details), 2.7 Å

PDB Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling
PDB Compounds: (B:) igg1-kappa 4d5 fab (heavy chain)

SCOP Domain Sequences for d1fveb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fveb2 b.1.1.2 (B:121-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOP Domain Coordinates for d1fveb2:

Click to download the PDB-style file with coordinates for d1fveb2.
(The format of our PDB-style files is described here.)

Timeline for d1fveb2: