SCOPe 2.04: Domain d3etgf2: 3etg F:209-501

Lineage for d3etgf2 (3etg F:209-501)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein automated matches [227005] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [225674] (3 PDB entries)

8. Domain d3etgf2: 3etg F:209-501 [209662]
   Other proteins in same PDB: d3etga1, d3etgb1, d3etgc1, d3etgd1, d3etge1, d3etgf1
   automated match to d1nr7a1
   complexed with glu, gtp, gwd, ndp

Details for d3etgf2

PDB Entry: 3etg, 2.5 Å

PDB Description: glutamate dehydrogenase complexed with gw5074

PDB Compounds: (F:) glutamate dehydrogenase

SCOPe Domain Sequences for d3etgf2:

Sequence; same for both SEQRES and ATOM records:

>d3etgf2 c.2.1.7 (F:209-501) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hgrisatgrgvfhgienfineasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfga
kcvavgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpeadkiflernimvipdlylnaggvtvsyfewlkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft

Timeline for d3etgf2:

• d3etgf2 first appeared in SCOPe 2.03
  
• d3etgf2 appears in SCOPe 2.05
  
• d3etgf2 appears in the current release, SCOPe 2.08