SCOP 1.69: Domain d2mcph2: 2mcp H:122-222

Lineage for d2mcph2 (2mcp H:122-222)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha [88580] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88581] (3 PDB entries)

8. Domain d2mcph2: 2mcp H:122-222 [20961]
   Other proteins in same PDB: d2mcph1, d2mcpl1, d2mcpl2
   part of Fab MCPC603

Details for d2mcph2

PDB Entry: 2mcp, 3.1 Å

PDB Description: refined crystal structure of the mc/pc603 fab-phosphocholine complex at 3.1 angstroms resolution

SCOP Domain Sequences for d2mcph2:

Sequence; same for both SEQRES and ATOM records:

>d2mcph2 b.1.1.2 (H:122-222) Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha {Mouse (Mus musculus)}
sesarnptiypltlppalssdpviigclihdyfpsgtmnvtwgksgkdittvnfppalas
ggrytmsnqltlpavecpegesvkcsvqhdsnpvqeldvnc

Timeline for d2mcph2:

• d2mcph2 first appeared (with stable ids) in SCOP 1.55
  
• d2mcph2 appears in SCOP 1.67
  
• d2mcph2 appears in SCOP 1.71
  
• d2mcph2 appears in the current release, SCOPe 2.08