Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha [88580] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88581] (3 PDB entries) |
Domain d2mcph2: 2mcp H:122-222 [20961] Other proteins in same PDB: d2mcph1, d2mcpl1, d2mcpl2 part of Fab MCPC603 |
PDB Entry: 2mcp (more details), 3.1 Å
SCOP Domain Sequences for d2mcph2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mcph2 b.1.1.2 (H:122-222) Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha {Mouse (Mus musculus)} sesarnptiypltlppalssdpviigclihdyfpsgtmnvtwgksgkdittvnfppalas ggrytmsnqltlpavecpegesvkcsvqhdsnpvqeldvnc
Timeline for d2mcph2: