Lineage for d3eggb_ (3egg B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679877Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1679878Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1679954Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 1679980Protein Protein phosphatase-1 (PP-1) [56311] (5 species)
  7. 1679998Species Human (Homo sapiens), gamma isoform [TaxId:9606] [111230] (2 PDB entries)
    Uniprot P37140 1-308
  8. 1680000Domain d3eggb_: 3egg B: [209500]
    automated match to d1s70a_
    complexed with gol, mes, mn

Details for d3eggb_

PDB Entry: 3egg (more details), 1.85 Å

PDB Description: crystal structure of a complex between protein phosphatase 1 alpha (pp1) and the pp1 binding and pdz domains of spinophilin
PDB Compounds: (B:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d3eggb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3eggb_ d.159.1.3 (B:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad

SCOPe Domain Coordinates for d3eggb_:

Click to download the PDB-style file with coordinates for d3eggb_.
(The format of our PDB-style files is described here.)

Timeline for d3eggb_: