Lineage for d3e9ib1 (3e9i B:4-145)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2400006Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2400007Protein automated matches [190576] (50 species)
    not a true protein
  7. 2400013Species Bacillus stearothermophilus [TaxId:1422] [225706] (2 PDB entries)
  8. 2400019Domain d3e9ib1: 3e9i B:4-145 [209435]
    Other proteins in same PDB: d3e9ia2, d3e9ib2, d3e9ic2, d3e9id2
    automated match to d1bbua1
    protein/RNA complex; complexed with 1pe, mg, xah

Details for d3e9ib1

PDB Entry: 3e9i (more details), 2.2 Å

PDB Description: Lysyl-tRNA synthetase from Bacillus stearothermophilus complexed with L-Lysine hydroxamate-AMP
PDB Compounds: (B:) lysyl-tRNA synthetase

SCOPe Domain Sequences for d3e9ib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e9ib1 b.40.4.0 (B:4-145) automated matches {Bacillus stearothermophilus [TaxId: 1422]}
elndqlrvrreklkkieelgvdpfgkrferthkaeelfelygdlskeeleeqqievavag
rimtkrgmgkagfahiqdvtgqiqiyvrqddvgeqqyelfkisdlgdivgvrgtmfktkv
gelsikvssyefltkalrplpe

SCOPe Domain Coordinates for d3e9ib1:

Click to download the PDB-style file with coordinates for d3e9ib1.
(The format of our PDB-style files is described here.)

Timeline for d3e9ib1: