Lineage for d3dusd_ (3dus D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744368Domain d3dusd_: 3dus D: [209316]
    automated match to d1ar1c_
    complexed with kdo, mg, pg4

Details for d3dusd_

PDB Entry: 3dus (more details), 1.95 Å

PDB Description: crystal structure of sag506-01, orthorhombic, twinned, crystal 1
PDB Compounds: (D:) Ig-like protein

SCOPe Domain Sequences for d3dusd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dusd_ b.1.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evklvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkakgytv
eysasvkgrftisrdnsqsilylqmntlraedsatyycardgyyvdamdywgqgtsvtvs
s

SCOPe Domain Coordinates for d3dusd_:

Click to download the PDB-style file with coordinates for d3dusd_.
(The format of our PDB-style files is described here.)

Timeline for d3dusd_: