Lineage for d3dlxa1 (3dlx A:40-286)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1395793Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 1395794Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 1395829Family c.124.1.2: CoA transferase alpha subunit-like [74656] (7 proteins)
    parallel beta-sheet of 7 strands, order 4321567
  6. 1395864Protein Succinate:CoA transferase, N-terminal domain [82464] (2 species)
  7. 1395865Species Human (Homo sapiens) [TaxId:9606] [225513] (1 PDB entry)
  8. 1395866Domain d3dlxa1: 3dlx A:40-286 [209226]
    Other proteins in same PDB: d3dlxa2, d3dlxb2, d3dlxc2, d3dlxd2
    automated match to d1ooyb2
    complexed with gol

Details for d3dlxa1

PDB Entry: 3dlx (more details), 2.2 Å

PDB Description: crystal structure of human 3-oxoacid coa transferase 1
PDB Compounds: (A:) Succinyl-CoA:3-ketoacid-coenzyme A transferase 1

SCOPe Domain Sequences for d3dlxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dlxa1 c.124.1.2 (A:40-286) Succinate:CoA transferase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tkfytdpveavkdipdgatvlvggfglcgipenlidallktgvkgltavsnnagvdnfgl
glllrskqikrmvssyvgenaeferqylsgeleveltpqgtlaeriraggagvpafytpt
gygtlvqeggspikynkdgsvaiaskprevrefngqhfileeaitgdfalvkawkadrag
nvifrksarnfnlpmckaaettvveveeivdigafapedihipqiyvhrlikgekyekri
erlsirk

SCOPe Domain Coordinates for d3dlxa1:

Click to download the PDB-style file with coordinates for d3dlxa1.
(The format of our PDB-style files is described here.)

Timeline for d3dlxa1: