Lineage for d3dk9a2 (3dk9 A:166-290)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1351449Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1351450Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 1351953Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 1352039Protein Glutathione reductase [51944] (3 species)
  7. 1352057Species Human (Homo sapiens) [TaxId:9606] [51945] (22 PDB entries)
  8. 1352059Domain d3dk9a2: 3dk9 A:166-290 [209218]
    Other proteins in same PDB: d3dk9a3
    automated match to d3grsa2
    complexed with fad, so4

Details for d3dk9a2

PDB Entry: 3dk9 (more details), 0.95 Å

PDB Description: catalytic cycle of human glutathione reductase near 1 a resolution
PDB Compounds: (A:) glutathione reductase

SCOPe Domain Sequences for d3dk9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dk9a2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}
sqipgaslgitsdgffqleelpgrsvivgagyiavemagilsalgsktslmirhdkvlrs
fdsmistncteelenagvevlkfsqvkevkktlsglevsmvtavpgrlpvmtmipdvdcl
lwaig

SCOPe Domain Coordinates for d3dk9a2:

Click to download the PDB-style file with coordinates for d3dk9a2.
(The format of our PDB-style files is described here.)

Timeline for d3dk9a2: