Lineage for d3dg7c1 (3dg7 C:1-124)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2555235Species Mycobacterium smegmatis [TaxId:246196] [225617] (5 PDB entries)
  8. 2555242Domain d3dg7c1: 3dg7 C:1-124 [209166]
    Other proteins in same PDB: d3dg7a2, d3dg7b2, d3dg7c2, d3dg7d2
    automated match to d1nu5a2
    complexed with mg, muc

Details for d3dg7c1

PDB Entry: 3dg7 (more details), 2 Å

PDB Description: crystal structure of muconate lactonizing enzyme from mucobacterium smegmatis complexed with muconolactone
PDB Compounds: (C:) Muconate cycloisomerase

SCOPe Domain Sequences for d3dg7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dg7c1 d.54.1.0 (C:1-124) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mkivaigaipfsipytkplrfasgevhaaehvlvrvhtddgivgvaeapprpftygetqt
givavieqyfapaligltlterevahtrmartvgnptakaaidmamwdalgqslrlsvse
mlgg

SCOPe Domain Coordinates for d3dg7c1:

Click to download the PDB-style file with coordinates for d3dg7c1.
(The format of our PDB-style files is described here.)

Timeline for d3dg7c1: