Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (78 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [225618] (5 PDB entries) |
Domain d3dg3a2: 3dg3 A:125-366 [209159] Other proteins in same PDB: d3dg3a1 automated match to d1nu5a1 complexed with mg |
PDB Entry: 3dg3 (more details), 1.6 Å
SCOPe Domain Sequences for d3dg3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dg3a2 c.1.11.0 (A:125-366) automated matches {Mycobacterium smegmatis [TaxId: 246196]} ytdrmrvshmlgfddpvkmvaeaeriretygintfkvkvgrrpvqldtavvralrerfgd aielyvdgnrgwsaaeslramremadldllfaeelcpaddvlsrrrlvgqldmpfiades vptpadvtrevlggsataisiktartgftgstrvhhlaeglgldmvmgnqidgqigtact vsfgtafertsrhagelsnfldmsddlltvplqisdgqlhrrpgpglgieidpdklahyr td
Timeline for d3dg3a2: