Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (55 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [225439] (5 PDB entries) |
Domain d3dfyi1: 3dfy I:3-124 [209142] Other proteins in same PDB: d3dfya2, d3dfyb2, d3dfyc2, d3dfyd2, d3dfye2, d3dfyf2, d3dfyg2, d3dfyh2, d3dfyi2, d3dfyj2, d3dfyk2, d3dfyl2, d3dfym2, d3dfyn2, d3dfyo2, d3dfyp2 automated match to d1jpma2 complexed with mg |
PDB Entry: 3dfy (more details), 2.1 Å
SCOPe Domain Sequences for d3dfyi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dfyi1 d.54.1.0 (I:3-124) automated matches {Thermotoga maritima [TaxId: 243274]} rivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngervea llaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyll gg
Timeline for d3dfyi1:
View in 3D Domains from other chains: (mouse over for more information) d3dfya1, d3dfya2, d3dfyb1, d3dfyb2, d3dfyc1, d3dfyc2, d3dfyd1, d3dfyd2, d3dfye1, d3dfye2, d3dfyf1, d3dfyf2, d3dfyg1, d3dfyg2, d3dfyh1, d3dfyh2, d3dfyj1, d3dfyj2, d3dfyk1, d3dfyk2, d3dfyl1, d3dfyl2, d3dfym1, d3dfym2, d3dfyn1, d3dfyn2, d3dfyo1, d3dfyo2, d3dfyp1, d3dfyp2 |