Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein automated matches [190545] (9 species) not a true protein |
Species Paracoccus versutus [TaxId:34007] [225566] (1 PDB entry) |
Domain d3c75b_: 3c75 B: [208815] Other proteins in same PDB: d3c75l_, d3c75m_ automated match to d1id2a_ complexed with cu |
PDB Entry: 3c75 (more details), 2.5 Å
SCOPe Domain Sequences for d3c75b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c75b_ b.6.1.1 (B:) automated matches {Paracoccus versutus [TaxId: 34007]} qdkitvtsekpvaaadvpadavvvgiekmkyltpevtikagetvywvngevmphnvafkk givgedafrgemmtkdqayaitfneagsydyfctphpfmrgkvive
Timeline for d3c75b_: