Lineage for d3bn4d_ (3bn4 D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1655310Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 1655311Family d.58.56.1: CcmK-like [143415] (4 proteins)
    Pfam PF00936; BMC domain
  6. 1655345Protein automated matches [191074] (6 species)
    not a true protein
  7. 1655354Species Synechocystis sp. [TaxId:1143] [225417] (1 PDB entry)
  8. 1655358Domain d3bn4d_: 3bn4 D: [208682]
    automated match to d3sssf_
    complexed with so4

Details for d3bn4d_

PDB Entry: 3bn4 (more details), 2 Å

PDB Description: carboxysome subunit, ccmk1
PDB Compounds: (D:) Carbon dioxide-concentrating mechanism protein ccmK homolog 1

SCOPe Domain Sequences for d3bn4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bn4d_ d.58.56.1 (D:) automated matches {Synechocystis sp. [TaxId: 1143]}
iavgmietlgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsevqasvtagie
nirrvnggevlsnhiiarphenleyvlpiry

SCOPe Domain Coordinates for d3bn4d_:

Click to download the PDB-style file with coordinates for d3bn4d_.
(The format of our PDB-style files is described here.)

Timeline for d3bn4d_: