SCOPe 2.03: Domain d3bn4c_: 3bn4 C:

Lineage for d3bn4c_ (3bn4 C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.56: CcmK-like [143414] (2 families)
   contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape

5. Family d.58.56.1: CcmK-like [143415] (4 proteins)
   Pfam PF00936; BMC domain

6. Protein automated matches [191074] (5 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1143] [225417] (1 PDB entry)

8. Domain d3bn4c_: 3bn4 C: [208681]
   automated match to d3sssf_
   complexed with so4

Details for d3bn4c_

PDB Entry: 3bn4, 2 Å

PDB Description: carboxysome subunit, ccmk1

PDB Compounds: (C:) Carbon dioxide-concentrating mechanism protein ccmK homolog 1

SCOPe Domain Sequences for d3bn4c_:

Sequence; same for both SEQRES and ATOM records:

>d3bn4c_ d.58.56.1 (C:) automated matches {Synechocystis sp. [TaxId: 1143]}
iavgmietlgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsevqasvtagie
nirrvnggevlsnhiiarphenleyvlpiryt

Timeline for d3bn4c_:

• d3bn4c_ is new in SCOPe 2.03-stable
  
• d3bn4c_ appears in SCOPe 2.04
  
• d3bn4c_ appears in the current release, SCOPe 2.08